PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi05g05410.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family WRKY
Protein Properties Length: 145aa    MW: 16593.5 Da    PI: 8.2542
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi05g05410.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY99.71.8e-3157115159
                      ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
             WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                      ldDgy+WrKYG+K vk+++fprsYY+C++++C+vkk+++r ++d+++v++tYeg+H+h+
  Vradi05g05410.1  57 LDDGYQWRKYGKKIVKNNTFPRSYYKCAHRECNVKKQIQRHSSDEEIVVTTYEGTHTHP 115
                      59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.5E-3143115IPR003657WRKY domain
SuperFamilySSF1182904.84E-2849116IPR003657WRKY domain
PROSITE profilePS5081128.26552117IPR003657WRKY domain
SMARTSM007745.6E-3557116IPR003657WRKY domain
PfamPF031066.4E-2658115IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 145 aa     Download sequence    Send to blast
MEKHQVMLHT ASTSTALSSH FKDVEKQVSE ISSQNQSDKE AKHHRYAFQT RSAVDVLDDG  60
YQWRKYGKKI VKNNTFPRSY YKCAHRECNV KKQIQRHSSD EEIVVTTYEG THTHPVDKSV  120
ETFDQILGNL LIGNLFNNAP PTLE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-2647114774Probable WRKY transcription factor 4
2lex_A2e-2647114774Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150351e-101AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014499244.11e-106PREDICTED: probable WRKY transcription factor 43
SwissprotQ9FYA23e-43WRK75_ARATH; Probable WRKY transcription factor 75
TrEMBLA0A0L9UCF15e-90A0A0L9UCF1_PHAAN; Uncharacterized protein
TrEMBLA0A0S3RFI75e-90A0A0S3RFI7_PHAAN; Uncharacterized protein
STRINGGLYMA06G17690.24e-68(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF115634110
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13080.15e-42WRKY DNA-binding protein 75